PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS62937.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 51aa    MW: 5550.33 Da    PI: 9.3534
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS62937.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.97.2e-111445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g+WT+eEde+lv+++k  G g+W++ ++  g
       EPS62937.1 14 KGKWTAEEDEKLVNYIKANGDGSWRSLPKNAG 45
                     79************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-13549IPR009057Homeodomain-like
SuperFamilySSF466891.08E-8845IPR009057Homeodomain-like
PROSITE profilePS5129413.657951IPR017930Myb domain
PfamPF002491.1E-81445IPR001005SANT/Myb domain
CDDcd001674.10E-51645No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 51 aa     Download sequence    Send to blast
MGRTPCCDKI GLKKGKWTAE EDEKLVNYIK ANGDGSWRSL PKNAGAERVA G
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071652.13e-23PREDICTED: transcription factor MYB12
SwissprotO222641e-20MYB12_ARATH; Transcription factor MYB12
TrEMBLS8DT129e-31S8DT12_9LAMI; Uncharacterized protein
STRINGPGSC0003DMT4000292579e-21(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1548477
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.12e-22myb domain protein 41
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]